PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10015623m
Common NameEUTSA_v10015623mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 364aa    MW: 40410.7 Da    PI: 4.0402
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10015623mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF37.62.8e-121249239
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
                     +ie k  r+v fskRrng+  K +EL+ L +a+va++ 
  Thhalv10015623m 12 KIEKKDSRSVAFSKRRNGLYSKTSELCLLSGAQVAILA 49
                     79*********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.502348IPR002100Transcription factor, MADS-box
SMARTSM004323.4E-11366IPR002100Transcription factor, MADS-box
CDDcd002662.32E-24481No hitNo description
SuperFamilySSF554551.23E-15579IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-7525IPR002100Transcription factor, MADS-box
PfamPF003194.4E-131257IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-72540IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MVGMKRKISM EKIEKKDSRS VAFSKRRNGL YSKTSELCLL SGAQVAILAT PISSKSKVSF  60
YSFGHSSVDN VVSAFLKKQR PQEDLGLGFW WEDESLAKSE DTKELSDAVG SMSRMLQNLK  120
VLHSVAVENR EDMKKKDVVI QETHQELDRD QTLNLQSTTC ASSCTHDDPP ADFEGLVKNS  180
GEEDQTILAM SDINNNDNNG LVLGNLDGWD QELDLDQIFD FMTSSEGLSM NMEMDDVSTN  240
RNSCSDSVAY EDGAMVIHSN SDQTVATSDK NENNINALPV DHLDGCNQEL DLDQIFDYMT  300
SSEGMSMNLE MDDISMMMNT YQNLCSGSEA VEDIEAVVLD RDLDEDNPHL SDYFNELTSI  360
TAL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006398920.10.0hypothetical protein EUTSA_v10015623mg
TrEMBLV4LKM10.0V4LKM1_EUTSA; Uncharacterized protein
STRINGAT5G04640.12e-95(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45417145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04640.14e-99AGAMOUS-like 99